DPCstruct | MC17844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 16.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0NVT2 | 42-118 | FWISKWVDYSDKYGIGYQLCDNSVGVLFNDNTRIVLDTAGNQLTYIEKNNKEHYFNMEHATPVSLKKKITLLQYFRS |
| A0A0N5C0Y6 | 5-85 | LEPALTRWIDFNDKYGLGYQLSDSSVGVNFKNNSHLVVVDGAMKNFQYVDKNSVREYYEYNKCPTMLGKNLSYLNTLKKLW |
| A0A7R9CZY7 | 61-147 | None |
| A0A078ACF7 | 943-1063 | None |
| A0A7S3KP55 | 147-249 | None |
| A0A2P8XV35 | 162-243 | None |
| G4TXH6 | 14-127 | None |
| A0A7S1URN1 | 289-393 | None |
| A0A7S2UAU6 | 561-656 | None |
| A0A6G3MGY5 | 69-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.