DPCstruct | MC17843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E2U0 | 8-126 | VLLFSIITISFESSADFKTFNCETNSTEPCIIVMDPLGSTYNSTLFELADPLTALSLDFGMAEYQRNKPKVVGILNEIIRDEVNQTV… |
| A0A0N5BYV9 | 3-119 | FICTLLLIALSITFSFGLKTNCDKNDIQTCTIWMTPNETYYSSVFLTLIDPMIELAMDYAFEGNEPDVDPFNTVNELIIDEINKTTI… |
| A0A090KYB7 | 1-115 | None |
| A0A0K0E6V0 | 2-121 | None |
| A0A0K0EC72 | 1-120 | None |
| A0A090MRS4 | 11-116 | None |
| A0A090LRS9 | 1-102 | None |
| A0A090LJI3 | 1-155 | None |
| A0A0N5BU10 | 15-116 | None |
| A0A0K0E6V1 | 13-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.