DPCstruct | MC17842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K2D647 | 1-97 | MILAKPRYGQPCNGCGLCCAAERCPLAAHVFGPGDRCPALEAEGLRFRCGLIANPDRYAAELVMQHGRDAVAAAAAVLVGAGHGCDA… |
| A0A1G0CS32 | 10-104 | ELHALAPTKPACGADCNGCGVCCAAQPCPVALMFLLQWRGRCRALLWQEEARRYVCGMAVCPDRYVYPLPARWRARSGKWFATRIAA… |
| A0A6P1Q572 | 16-136 | None |
| A0A4Z0NFB5 | 14-105 | None |
| A0A0F9SS95 | 1-91 | None |
| A0A0F2RBS9 | 1-82 | None |
| A0A1H0N3J0 | 78-175 | None |
| A0A0F9K2J0 | 1-99 | None |
| A0A644XVD4 | 5-95 | None |
| A0A5J4SS07 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.