DPCstruct | MC17841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18862 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7ZL39 | 2-93 | ELIKAKGKFFLPENKSIKISGILTFSHQEGAILELLGTFTTIPGYHQIILGLTSEGKPVSLYRNEAIEYNLGSGFTVATFKSRYLFI… |
| A0A8A5UQ27 | 1-146 | MRKLVDLNAGESSTGLVFDGQDTAQIFATFLMDQDYGPLLKISYPGVASSSLDATYDHLELWSEGKAIPNTLVFSSVDGTATFHECV… |
| A0A839VKW8 | 10-127 | None |
| A0A496JTB9 | 12-135 | None |
| Q8VUX7 | 2-126 | None |
| A0A5B2VQD0 | 2-108 | None |
| A0A4U6N1F7 | 1-106 | None |
| U1R9Q5 | 7-144 | None |
| A0A1C3X345 | 5-122 | None |
| A0A1H7XWY6 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.