DPCstruct | MC1784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 169 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3C8F2 | 2-163 | SFSNREETLVNFLLTYYKNKMSLLRDIVNQNTPLSLRLLDWLVTNYSKKYNIIYPLYKTNGDIIYFNIYLDYKNQLKAYSKKYFDPF… |
| A0A2E6C0F1 | 1-129 | MSKSDVLLASIDQFYAQEQNRDTLISILQKKGKISLRNIEWFICSYAKKHNVTFKTSDGKAFAVHVNYKSSLDGYSKKLFDPFCRTE… |
| A0A835YYL9 | 213-368 | None |
| D8LPG7 | 23-201 | None |
| A0A6C0HSL8 | 3-162 | None |
| A0A1Y1I6M5 | 1-193 | None |
| A0A835Z129 | 35-217 | None |
| A0A6C0CMM0 | 64-217 | None |
| A0A836CL91 | 17-191 | None |
| A0A6C0DZN1 | 30-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.