DPCstruct | MC17838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1264 |
|---|---|
| Mean domain length (aa) | 187 ± 25 aa |
| Standard deviation of domain lengths | 24.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 73.69 |
| Assigned Pfam label(s) | CL0123- CL0174- PF00199- PF08287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0JYK1 | 1-142 | MFESLIEFADDSVFGLINKILDQEKDAVDRCGRIIHLLLGFSERNPGITRILLGDALVGENERLRIRVGQFFERIETQFRQVLREAN… |
| A0A4Q3GB86 | 20-217 | KVVQRAKRGSYDPEGTHTDIMAAGLQLFSEAGFAATTVQAVADRANVTKGAFYHHFESKEDLLRQIHSEYAVEILNSARSVSESGLS… |
| A0A5C4M714 | 5-185 | None |
| A0A0X8K8H2 | 7-203 | None |
| A0A6B2YH61 | 4-187 | None |
| A0A2E2W4M6 | 3-192 | None |
| A0A1X1MJ98 | 5-180 | None |
| A0A449GUS3 | 2-160 | None |
| A0A258V4W0 | 2-162 | None |
| A0A1H9HU26 | 3-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.