DPCstruct | MC17836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423FXL2 | 116-232 | QMALGSLLHIIQDSYSLGHTLRDFSPTTACPSGRVIQYYSYTNQDADLHHMTDTPTSWKAQGLVAPQDPVSASATVLRFASQRAEWT… |
| A0A4Q3G7U2 | 20-145 | REIAFGSVLHTVQDSFAAAHAEREPQSTGVQCEGSAYPMPAKIVEFHAYGAQDGALHDHDDSREAMTAVAMDRWPEAVEVTRNLFEL… |
| A0A521XH07 | 35-168 | None |
| M3GWQ2 | 621-726 | None |
| A0A5F2E178 | 212-315 | None |
| A0A644ZR79 | 27-158 | None |
| A0A828XZY6 | 1-104 | None |
| A0A437A4S7 | 61-182 | None |
| A0A855U4A6 | 510-615 | None |
| M6FI56 | 41-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.