DPCstruct | MC17835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419R038 | 18-121 | APASDKSDPLNGKLDTLPHGRWICEVPGDAAGPAVLPIPDSWFETINNSSYENPNGHGTYLLTGDQVHFTRGPMLGARFERTSANTL… |
| A0A4Q3G6L7 | 2-93 | GTLLTGRYQCEKPGDIGGVTRIRLPDEDFRVITGSNYISGGKRGSYLLTGDRVVMTGGPLKGHKYRKTSTRYLKMLKPNGKDGDQRC… |
| A0A4S3MPZ9 | 87-183 | None |
| A0A258TIN8 | 48-155 | None |
| A0A7Y9XT73 | 31-150 | None |
| A0A6M1SFV1 | 52-141 | None |
| A0A7X1NUB4 | 143-265 | None |
| A0A4R0NUF4 | 12-138 | None |
| A0A7T9EJC2 | 1-88 | None |
| A0A353YG15 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.