DPCstruct | MC17832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 163 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827T1B1 | 1-142 | MAKKVKKHDGRTSDLTFKWMLTTLGPEWEQWQELAAEWMATQHVGVDHKLSALSRFFESYLLDCAPYATDIGLFFKGYNGHICSTEE… |
| A0A7Z7FPW0 | 1-178 | MAEKKTTTASVASSGLVPKSKGVRRKTDASLGWVERDYPQLAAWRALAVEWLKGETRGVDDRLSALVAFFERYLVQQGLPLNPTEFL… |
| A0A327Q7R6 | 1-168 | None |
| A0A2C8ZNE9 | 1-175 | None |
| A0A2S5ITC0 | 1-163 | None |
| A0A2N0DTE2 | 1-162 | None |
| A0A1C3JJ30 | 1-150 | None |
| A0A0K9I240 | 62-222 | None |
| A0A1I0HPL8 | 531-687 | None |
| A0A849B3T8 | 238-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.