DPCstruct | MC1783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 415 |
|---|---|
| Mean domain length (aa) | 231 ± 51 aa |
| Standard deviation of domain lengths | 51.46 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 11.84 |
| Pfam Score | 98.43 |
| Assigned Pfam label(s) | CL0023- PF10238- CL0123- CL0060- CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1NQQ8 | 1-176 | MIINSNLLRAALVCVAQNDPRYYLCGVHITPKYLESTNGHVALRLEHGVNTRRKAIVQFHGKIPKKAETTELHFTKEPYAVHRNVNG… |
| A0A2E5YWY3 | 11-238 | FKKIIDAIKDVCKETNIEINESGLKIKSMDSSHVCLVNLNISSSIEEIICENPAVIALNLDQMSKILRLFDNEAQLIIVHNENKLIL… |
| A0A6A6KVW9 | 132-394 | None |
| A0A7C4M8N7 | 6-197 | None |
| A0A151H478 | 25-306 | None |
| A0A1Q9CMY1 | 851-1103 | None |
| A0A1Q9CMW4 | 12-272 | None |
| A0A1Q9BXK1 | 189-516 | None |
| U5NW26 | 2-189 | None |
| K2SLP9 | 30-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.