DPCstruct | MC17829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07892 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0AEC1 | 15-101 | VGYKCKRGKDYARQEATHPVRMVTASVPVEGRLSPVSVKTAQPVPKNKIMQVAAVLAAARVQPPVREGDVVVADICDTGIDAIATKT |
| A0A354M8V0 | 1-86 | MGNSCPKGKQYAIDECTNPTRTVTSSVRVENREDTMVSVKTASPVPKDKIFEVMRLIRAKSVCAPVKIGDVIIEGVFGTNIVATKN |
| A0A355IE08 | 32-137 | None |
| A0A497P2X2 | 11-99 | None |
| D4L156 | 2-89 | None |
| A0A7C1CDR2 | 12-78 | None |
| A0A7C6Z7S1 | 18-118 | None |
| R5HPD1 | 56-157 | None |
| C5EIC8 | 7-103 | None |
| A0A3N0AAV0 | 19-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.