DPCstruct | MC17827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 226 ± 35 aa |
| Standard deviation of domain lengths | 34.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9FKK3 | 12-256 | DGLVLAVPDGRPGPPPLRFERAKGRGWVLRQGERPLIQARSEGDGCCRNLHLRRLPGHRSPLPPISAATMRSRTNWPHRYGRWLEET… |
| A0A354CVM2 | 6-251 | SSESVLINNKEYTIVGVSNSPNSFGLCDTTMQKDKGIRETFFIGNEALLNIVQRSINDPYSNKIISQVSTMDRCGDFPRRSAAAVED… |
| A0A2P6NU69 | 86-321 | None |
| A0A7T9E5F4 | 14-182 | None |
| A0A7T9IG57 | 42-271 | None |
| A0A4S8Q9L8 | 57-223 | None |
| A0A430ACE5 | 8-267 | None |
| A0A5B0WGU2 | 28-190 | None |
| A0A0D9LRV3 | 37-241 | None |
| A0A0F7JQS2 | 40-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.