DPCstruct | MC17826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 231 ± 25 aa |
| Standard deviation of domain lengths | 25.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7QXX9 | 144-374 | PEVIRLPESVKKIGSLAFYNCGNLKELTVGKNLCGIGSDAFMNCRKLKALIVMADVREKTGLKQILAQISWDITVSFLCGGNIRAKI… |
| A0A354CQX5 | 17-242 | EIVLSEELEEIRDYAYSDNPIERVVVPKSVKAIGKRAFNTKYIEIYDKEQSLVSGCEPFSSEDHLLVVRSAETDEIKFVVPVYHGEL… |
| A0A1Q9K5D3 | 5-259 | None |
| A0A395YKT0 | 2-193 | None |
| A0A3C1DB65 | 638-863 | None |
| A0A1G9ZU88 | 107-343 | None |
| A0A3R6UMF4 | 2-229 | None |
| A0A7K0G9F5 | 229-457 | None |
| A0A847X997 | 468-671 | None |
| A0A7X5DEE2 | 566-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.