DPCstruct | MC17824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2K5H7 | 45-161 | PKNEDAVVCIVGDRQTGKTTRLIEISAATGIPIVTCNFGIASHIYHQAKRNGYDMPKPLCLNGSSFERSYASHYEKGMPVLVDELQM… |
| A0A4U2Y5T1 | 7-85 | FPTVYVGERKSGKTTRLLEEASKTGIPILAHNIMMKRYLEGTAKQLGFTNVTVITPDALEHGHYEKVIIDEAQLLLRYA |
| A0A430AW10 | 4-98 | None |
| A0A349YM60 | 1-106 | None |
| A0A0F9SPK1 | 1-100 | None |
| A0A174QFQ0 | 1-102 | None |
| A0A843F949 | 1-89 | None |
| A0A8B4D5D6 | 1-107 | None |
| A0A5Q2SEY6 | 2-104 | None |
| A0A0F9H1L8 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.