DPCstruct | MC17823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 161 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.96 |
| Pfam Score | 96.03 |
| Assigned Pfam label(s) | PF15058- PF15059- CL0453 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7HNY0 | 3-149 | SPDTIIFGEVAFQLERVVLSRVFRGGSKQLTGYTLSNMEKMIQSHYDNHERPMLGRQLDEIEGELHMCGWDRDYHPGLVAHLIKKFG… |
| A0A402EZV2 | 11-175 | VDAFLKKLEVAQNNKKNGRVVGEIAFQLDRRILAHVFPGITRLYGFTVSNIPEKIKQVSMKSLDGSLDEKKYRAMTQRYLDLFAHLE… |
| H0VFL3 | 245-410 | None |
| W5MQY8 | 167-341 | None |
| A0A6I9YIC2 | 815-992 | None |
| A0A813VXM1 | 494-662 | None |
| A0A670ZU35 | 217-393 | None |
| A0A177B5F0 | 63-237 | None |
| G7MMA0 | 152-290 | None |
| A0A437CIS4 | 113-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.