DPCstruct | MC17822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 173 ± 35 aa |
| Standard deviation of domain lengths | 34.88 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF04502- PF08641 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402EUP1 | 1-150 | MAAEAEAVPSAAPPSSPGRDPRVRCRSRRWTAELMGHCKAYMRALGDEQPVEAESLKWALSEAAWNFETAVHENITVNGEPWQESSD… |
| A0A673MA07 | 1-123 | MEADRESGADFRVNVKSKKHVREQLEKYKDLFKKLLDGQCHISEEDKAKLLQEMVVNSEFTVQENLVIAGLSWDEVSEDYCEDYDST… |
| A0A2T7NYW6 | 1-159 | None |
| A0A7M4DVV2 | 28-190 | None |
| A0A060WL09 | 1-139 | None |
| A0A670Z4U6 | 29-183 | None |
| A0A0A1TNS3 | 3-225 | None |
| A0A4R0S1H2 | 48-236 | None |
| A0A1B8EJ28 | 198-439 | None |
| A0A7J5YLA8 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.