DPCstruct | MC17820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 240 ± 29 aa |
| Standard deviation of domain lengths | 28.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182EHV9 | 32-286 | EIDVDWKSLVRTALLPLTTDFFPDERSINADYVVKAHQLPVYFDLVREWLGDSRCDDLEQLRNLVFDQLVCQRLQRGFQIVLLNKKM… |
| A0A402EIS2 | 1-207 | GVDWKSLTTPACLPLTTDYFPDRQSLQNDYTEGCYDLLPEADLDRRDEEGVQMTAHQVFEEFICQRLMQGYQLIVQSKPQKPAAAVQ… |
| U3IIE0 | 30-294 | None |
| A0A6P4KK34 | 767-1023 | None |
| M4BL07 | 186-399 | None |
| A0A2G9S572 | 17-221 | None |
| A0A0M8MR98 | 26-247 | None |
| A0A7D8Z5H5 | 326-637 | None |
| A0A0G2K6M8 | 731-997 | None |
| L0P6Z8 | 143-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.