DPCstruct | MC17819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2GS20 | 12-152 | QWLDENEDVSMDFLNGALGRDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIKKLECPNPQALAHFMCRFAKTINKVLLQYAVIIA… |
| A0A402EII8 | 89-229 | QWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIIS… |
| A0A060WYM3 | 163-303 | None |
| A0A3Q0KMC8 | 1691-1841 | None |
| A0A044S3H3 | 1220-1361 | None |
| A0A183LK30 | 365-511 | None |
| F1QVH9 | 992-1139 | None |
| H9GC95 | 647-762 | None |
| A0A6H5HE19 | 354-499 | None |
| A0A2I0T701 | 252-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.