DPCstruct | MC17818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 60 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.04 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | PF00643- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151NDM3 | 1-54 | MVCEQHGEALKLFCETDQVLMCLICQESRAHRAHPAAPIQEAAQQCKEQLQTQL |
| A0A402EI69 | 46-105 | CQNMLAVLSIRKGRVCQKHQEPLKLFCKDDEALICVVCDRSKEHRGHETLPLEEASQEYK |
| A0A4W3GGD1 | 18-65 | None |
| A0A6J2ASD1 | 207-276 | None |
| A0A0F8AD76 | 80-133 | None |
| A0A0G2JTG0 | 89-150 | None |
| A0A402FLU6 | 524-577 | None |
| A0A151MYU4 | 20-85 | None |
| A0A3P9DTN0 | 168-232 | None |
| S7MM68 | 700-753 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.