DPCstruct | MC17817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 94.17 |
| Assigned Pfam label(s) | CL0409- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2UPL8 | 175-317 | IMPEEEYSEFKEIILQKELHVVYALSHVCGQDRTLLAGILLKIFLHEKLESLLLRSLNDKEISMEAEATTLFRATTLASTLMEQYMK… |
| A0A402EGB4 | 14-195 | KGWYRLLPFPSTEEDAGGKLGALRLRVRLAEDRILPSRYYQPLIDLLVESVLRPLEEKDDVTPLAVLEEVCSVESRQDVATKLVKIF… |
| A0A6J0JA67 | 203-374 | None |
| A0A3Q1ER52 | 240-384 | None |
| A0A8B6F9W0 | 106-276 | None |
| A0A674IAL3 | 85-276 | None |
| A0A674IJ53 | 391-534 | None |
| J9EMJ6 | 10-183 | None |
| A0A1Y1YJD6 | 326-498 | None |
| A0A0S7KDH1 | 19-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.