DPCstruct | MC17814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 111 ± 5 aa |
| Standard deviation of domain lengths | 4.50 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 66.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402EE86 | 1-109 | KKCCYCCFMGKAARKQGNSCEQSLQMGYQCGLVFRACCVEGQEGTDPLMVDSPNKDIALPVEVDHEDPYRHDRCRGGGPCTQQCRDT… |
| A0A674CEL0 | 815-920 | VCCSCCVLGLALHAEGRGCDAHQYLGDPCGHVLLTCCEEEGLSPNPNKTQRKKEMPRPTALSEKDVNECWSYPGRLCAQTCENSPGS… |
| A0A5S6R2B7 | 141-259 | None |
| A0A673IU70 | 34-141 | None |
| A0A085M9A4 | 97-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.