DPCstruct | MC17812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2IEI3 | 1-141 | MQTVYSSGIYHIGPGHRGRVCITLEPAQLLKGDIMIKCYHKSEATSEREEVFRLQFHTGAVQGYNLVFDKEDMETANKDPRFADYGK… |
| A0A402ECN6 | 1-124 | LEPALLLKGDVLVKCYHKQLQGAERDVVFQVQLHTCTIHSTQLWFSKDELDEAWRDERFPFEASVEFVFSSSPEKLKGRETYRNHAA… |
| A0A2G9S330 | 112-246 | None |
| A0A164RM23 | 333-475 | None |
| A0A1S3MWR2 | 102-242 | None |
| A0A3M0J068 | 57-177 | None |
| F1Q649 | 268-410 | None |
| A0A5K4FF32 | 560-668 | None |
| A0A556TSX1 | 122-243 | None |
| A0A6L5CT82 | 43-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.