DPCstruct | MC17810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 354 ± 58 aa |
| Standard deviation of domain lengths | 57.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4PCD6 | 1-428 | LCSALLCSAVSLMSSHLLTQIEHPLMVKLAQANKIEEKLMRERNKRVFERAKFLVEDVREREVQLSQSLDRMLGNRFKSEMEAIKGA… |
| A0A4Z2FUU6 | 3-266 | SLLIDAYDLIDWRQFLLSAALPWPFPSLSQLLVVLQRFKAADAGHSGSVDEDQYLQTELWFSNESVQPVPDDPSEPLPYDRLANIRK… |
| A0A834CLN6 | 554-937 | None |
| A0A7S0R874 | 15-400 | None |
| A0A3B5LGY1 | 733-1047 | None |
| T1FRF5 | 82-380 | None |
| A0A498P2H4 | 624-1007 | None |
| A0A2G8L0A4 | 87-478 | None |
| A0A7S4PBY1 | 293-641 | None |
| V5AXM8 | 1-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.