DPCstruct | MC17807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 2.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 57.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402EBH1 | 1-56 | INKFDYVFAENGTVQYKNGQLVSKQAIQDHLGEELLQELINFCLSYIALLKLPKKR |
| A0A673V1S9 | 33-89 | VVEKYDYVFPENGLVAYKDGKLLCKQNIQGHLGEALIQDLINYCLSYIAKIKLPKKR |
| A0A340X4F5 | 143-205 | None |
| A0A7J6GUY8 | 410-469 | None |
| T1IKQ5 | 88-146 | None |
| A0A1A8WWN3 | 2-56 | None |
| A0A1S3WN04 | 33-91 | None |
| A0A835NKZ0 | 50-106 | None |
| A0A1A8MZE4 | 66-126 | None |
| A0A6I9PZT9 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.