DPCstruct | MC17806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 117 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4NU76 | 24-137 | YTEVQRVLREEVVNPLRKHGYVRADRVMKLRTLLERLSDVPGLTSEEKDPEEFLNGLVAQLLRAEPFLKLSSGQEAYCYQLFVEKDE… |
| A0A402EA26 | 170-265 | RYGYVGAENIMHLRKLLRSDSFVTEEKDPEEFLNVLLGEVLATEPLLRIKADNEVLEYNCYQVLVERGSMVHMPTVQQLLEESLLSY… |
| A0A0N4ZNK9 | 522-624 | None |
| A0A6P8QSG8 | 468-566 | None |
| A0A183U7Y3 | 6-108 | None |
| A0A1L8EU43 | 257-351 | None |
| A0A3P8QZT6 | 559-700 | None |
| A0A1A7Z6F6 | 434-563 | None |
| T1FYR1 | 108-231 | None |
| A0A485N9D0 | 398-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.