DPCstruct | MC17804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CAL3 | 202-296 | LCPDWETWDPSQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKSKLKPGAPLRSKTLHPKKAKAYGPVRVFV… |
| A0A4W5KMW0 | 312-403 | LCPDWDQWDQTKPVDNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKSKLKPGAPLRPKLNPKKARAYGPGTHPHT… |
| A0A5K4E7M6 | 199-303 | None |
| A0A3S5ADC7 | 100-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.