DPCstruct | MC17803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 71.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402E7D2 | 1-69 | MFGFHKPKMYRSLEGCCICRAKSSSSRFTDSKRYEKDFQNCFGLHEARSGDICNACVLLVKRWKKLPAG |
| A0A1L8DC70 | 1-69 | MFSFHKPKVYRSTQGCCICKAKSSSSRFTDSKKYETDFIECFQLTSPRKGEICNACVLLVKRFKRLPPG |
| W6U509 | 62-132 | None |
| A0A5K4ESP4 | 4-80 | None |
| A0A3Q1F3P9 | 115-190 | None |
| A0A1I8NDH5 | 1-69 | None |
| A0A7J7WTD2 | 1-69 | None |
| A0A836D148 | 1-83 | None |
| A0A7I8VR83 | 1-69 | None |
| A0A5F4BPG8 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.