DPCstruct | MC1780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 4.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4UJA9 | 95-180 | LKQLLNNCHKTRFNVWVHNAPYDSKDLLKSRGYRWSINPQANYKAWMIEVFEDTLETELTFLNSNVYKTPYNIPVQTINPCDRFMG |
| A0A7X0IV08 | 25-111 | FAELYEASKQSRVHIFAENSPFDQKDRLKARGYRWSDGSDGRPKSWWIEVAEEAMEDELRFLRSDIYRWDEADPPVQRLTAFDRFRS |
| A0A511GW14 | 98-176 | None |
| A0A4R2TFW0 | 161-241 | None |
| A0A222P3V5 | 9-87 | None |
| Q4UJH2 | 299-377 | None |
| A0A5C7NU29 | 6-83 | None |
| A0A4Q6FYT8 | 108-187 | None |
| A0A2E8JRS1 | 204-293 | None |
| A0A2M8VGT9 | 567-646 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.