DPCstruct | MC178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 191 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0JJR2 | 1-150 | MKIFRFKFSSELNNEIMNFSDIHKFDTDETLLDTFTEWIEKPHIKDLMDKEEVFLVRNEYEMSIEKKVFKSIKYYYIKKFKKNESKD… |
| A0A6C0BRK5 | 1-177 | MENSTENVQSQIFRFKFNSELLDKIEYFSKLHEHDDRKTYKEEWKKWVDTDEMSEIITAETERLNRLGYYENINNKMYRSSRYYFRK… |
| A0A6C0CVC8 | 33-235 | None |
| A0A6C0LQI6 | 36-238 | None |
| A0A6C0JXR7 | 8-205 | None |
| A0A6C0I858 | 2-199 | None |
| A0A2E5WN58 | 1-197 | None |
| A0A6C0EUS6 | 19-217 | None |
| A0A6C0KGR9 | 2-178 | None |
| A0A6C0F5M2 | 20-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.