DPCstruct | MC17796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 126 ± 24 aa |
| Standard deviation of domain lengths | 23.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.52 |
| Pfam Score | 93.59 |
| Assigned Pfam label(s) | PF12142- CL0205- CL0122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830D9B7 | 66-201 | RQMVSNSKTPRLFFGSPYRRGDEPNPGSGSIENIPHGPVHVWTGDSTQPNLENMGNFYSAGRDPIFYGHHSNIDRLWSVWKTLGGRR… |
| A0A176WHV9 | 16-127 | GVEFKHGDPQNLDINGGGSLEFLPHNSVHRWIGGSTALTTHAPEDPIFYVFHSNLERLWDVWQKLGNSRTDPSTPDWLDAEFLFFDE… |
| A0A6A3B1Z4 | 145-246 | None |
| A0A835JP46 | 169-306 | None |
| A0A4Y7KXC4 | 11-134 | None |
| B9XQZ3 | 613-719 | None |
| A0A6G1E4S6 | 1-102 | None |
| A0A0A0LRV2 | 155-268 | None |
| A0A396I5T8 | 252-381 | None |
| A9TFU4 | 111-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.