DPCstruct | MC17792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7HXX9 | 1-130 | MALRVVGLDQPGVLEQWWDMARAKNLAQFEAALQRLQLPMFTVMYADRDGHIMHLFNGQVPIRREGDYEFWSGVIPGDTSKTLWTKY… |
| A0A7Z0I2N2 | 1-129 | MTRQTPYGPILSDLDLLSDTDGTFAVRWTGHTVTDETTALLKAMRARSVPEFQTAVEGFAFPPLTFLAADDAGNVGAVTAARVPARA… |
| G0QS38 | 91-231 | None |
| A0A2V7TW50 | 29-145 | None |
| A0A1Z9BG41 | 407-534 | None |
| A0A7Y3PLG7 | 2-123 | None |
| A0A418W9A2 | 291-420 | None |
| M6GI27 | 25-170 | None |
| A0A0V0QUC2 | 325-450 | None |
| A0A7C1W8Q0 | 246-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.