DPCstruct | MC1779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H2IFM7 | 18-127 | APPERTRKAAPFSLRLSDKERARLKREAAGKSLGGYIKSRLFDEGKPNRSELAEMLGLLGQSGYAESLAILVEEAQTGSLLLDKQTL… |
| A0A7W8DT57 | 5-127 | EKGKKQEAKNFTLRLTDEEKRLLIERAGDVPLGIYIRGLILGADVRQKRRSAPLKDNTALARVLAVLGQSRLSSNLNQLAKAVHIGA… |
| A0A1G5N978 | 5-130 | None |
| A0A1H9SPL7 | 5-104 | None |
| A0A1Q3YVC5 | 6-132 | None |
| A0A651FMQ7 | 1-133 | None |
| A0A5C7QC91 | 12-128 | None |
| A0A850SW07 | 1-114 | None |
| A0A327JF93 | 30-153 | None |
| A0A1S1N1Q5 | 25-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.