DPCstruct | MC17780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 185 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368VJC7 | 1-158 | MPLEIKIIKRYLALHGKKVSERQVSLLYKVIQKAATEKTIRKSSKYAEEVKRIGNDLANTYKEMGESCTFEVPDSLHSKLKNIVDSY… |
| A0A7D5RQZ2 | 3-186 | KKKESTPKEKKVRQSKEPKNVKHVEHIREEVKFIKRYVGLHNKVKTPNAILAFIKALQRSIVQKLIRKTSPLSGEIEMIQNKLVQAY… |
| A0A553GMI0 | 108-291 | None |
| A0A6A2EYQ5 | 172-340 | None |
| A0A7W1FW38 | 67-260 | None |
| A0A7W4DVC4 | 119-299 | None |
| A0A369QK13 | 71-279 | None |
| A0A7L4ZH56 | 151-343 | None |
| A0A7Y7NZY4 | 253-432 | None |
| A0A2T6BQ85 | 280-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.