DPCstruct | MC1778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9ADQ4 | 2-91 | SAEKEPDEEEVRVRRAPKLAPFVLLGVAVGLIGTLLATSFFPADPSVGFAVLAGYFSLYGVTAGLVAGILVWLILDRRSKRDEKRAR… |
| A0A1E4M2M5 | 2-93 | STPETDQVTVRRAPRIPAFLFVGGAVGVIVTLVLTSLYPADPAVGFAALFAYFALYGITGGVVLGAVVGIIVDRVSSRRAKTVTVEH… |
| A0A853CUG9 | 32-144 | None |
| A0A7Z0J7X0 | 1-124 | None |
| A0A2H1L4W2 | 1-104 | None |
| A0A100XSI6 | 1-100 | None |
| A0A851HH37 | 2-98 | None |
| A0A846LUX6 | 7-113 | None |
| A0A1T5KV37 | 61-179 | None |
| A0A8B0KSB2 | 5-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.