DPCstruct | MC17778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0N9E3 | 1-132 | MCTLIFCTAFAQYRTERTGYEGDHFSLEGALDLFKESSSLRDFERRINTEKYWVNNLDLDYDGRIDYVRVEHRQQGNFHAIILQALV… |
| A0A7D5MLE1 | 1-162 | MKTLWMKTIVLMFLGAGTLHGQDREQVPGDNFSLEGALELFKKSASPEEFERLLNSPESEVNNLDLNGDGNIDYIRVIDRTERNIHT… |
| A0A1G0SYV2 | 3-172 | None |
| G8XBA7 | 1-164 | None |
| A0A2A2XUA7 | 1-165 | None |
| A0A1I2CEG4 | 28-169 | None |
| A0A2U1JQE1 | 1-168 | None |
| A0A5C7JV34 | 4-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.