DPCstruct | MC17775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 48.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4UTJ5 | 125-220 | MAGYLYEFVLVADESVLKDIANGESVVKAVSLSWSEGFSGWGWMRIPTSYLLDLWMLLSRHSFGTESVISFNGPEKDLDTYVWPGDV… |
| N4U4I4 | 1-106 | MADWLFDYVLLADEAVLMDVERGEFIVKAVSFKWKDGKFDSTWGWMRIPTGYLLELWHHLMLNDLRTEHALSFYRDEGELEDLIWAG… |
| X0LK93 | 1-115 | None |
| X0L6I4 | 651-759 | None |
| A0A5Q3GB47 | 395-504 | None |
| W9NNF7 | 137-259 | None |
| A0A420MFR5 | 63-174 | None |
| A0A366SA59 | 148-256 | None |
| A0A5Q3GBB9 | 126-256 | None |
| A0A7S8HQV0 | 122-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.