DPCstruct | MC17774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 252 ± 20 aa |
| Standard deviation of domain lengths | 19.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4U1Z3 | 1-281 | MELGSEEIEAIQYFRESFSPLYIMKKPQYSAFAIMLRLATHDPLVLHMILAIGGCGIDYRHQWRDRRYRVSTGRSEDSPSKYRTLGL… |
| A0A7G5J0S9 | 537-794 | LVLSEHDQKYFQYFPSSSLVFYYMKSWQWSSFCYLYQGPAATNKIIMRMILALSASDMHRNGLIVRTPGRPTAEDHGRYHYGLAVKE… |
| A0A545UMF1 | 55-304 | None |
| A0A135V7A2 | 13-268 | None |
| I7ZST9 | 1-275 | None |
| A0A094GRU3 | 863-1117 | None |
| A0A428PXM6 | 2-213 | None |
| A0A3M2SP99 | 2-233 | None |
| A0A5N6E2N0 | 7-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.