DPCstruct | MC17770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 174 ± 32 aa |
| Standard deviation of domain lengths | 31.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07841 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182GZ87 | 1-119 | MKEPKPMAQRRHRRDLYHKLEVAMNDMGYSGRDCILRALCESSQYFGKKGSNMIAEMLRTLFSFPKSKVLSFEHSDTRIYDEAHRKG… |
| A0A6J2TMU7 | 27-216 | TSMSLTSSVSIPVHAFYPDRRILIDWCFSVGYDLPNSLSSFYNIPIWPGFANLPQTQAQTKRELPRNKTEFEMYAKYGRDGLAQMHP… |
| A0A1B0AIA5 | 15-203 | None |
| A0A7E5WY39 | 1-154 | None |
| A0A3Q0IML6 | 1-140 | None |
| A0A1D2N069 | 34-228 | None |
| A0A1D2N081 | 187-346 | None |
| A0A6P4EYG8 | 2-191 | None |
| A0A1A9XQS2 | 256-440 | None |
| A0A6P4EEG6 | 9-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.