DPCstruct | MC17765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194S6R7 | 12-82 | DKYAQDVFYSSRYNDTHEYRHVILPKALVKYLPKERLPEEDEWRSLGIRQSPGWWAYERHAPEPHILLFKR |
| A0A4V4NFB9 | 69-152 | ERIFAYRDKYYYSPRYSDDDYEYRHVALPRDLLKIIPSDYFCENGTFKILQEDEWRSQLGITQSLGWVHYGCHAPEPHILLFRK |
| E4ZV58 | 850-933 | None |
| A0A1J8Q6Q5 | 10-88 | None |
| A0A368FKQ1 | 285-361 | None |
| A0A1W0XDG8 | 43-119 | None |
| A0A4T0IGY9 | 7-88 | None |
| A0A287PT38 | 40-115 | None |
| A0A7R9KLN9 | 90-166 | None |
| A0A6A3B6N5 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.