DPCstruct | MC17764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 164 ± 22 aa |
| Standard deviation of domain lengths | 22.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0172- PF04420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q17H90 | 296-436 | ILPLVLREPPQLISLRAQIEQARRELAKISMRENYLEYVHKERALVQLEKEMAVPRDSYNSRKLIYDYGIGYGLYAVLALGLIGISI… |
| A0A4T0X0W7 | 12-195 | LLATITIVTIITYIFTYLINREKCSNWIASKFLGDKDSIKKLSVLSKERRQIELERNSISAQDQYAKWTKLNRKLNKLNDEITGLSE… |
| A0A1B7P123 | 1-145 | None |
| K7GWG2 | 8-175 | None |
| A0A4W3H3U1 | 230-380 | None |
| L8HFW6 | 11-169 | None |
| K9GE77 | 10-180 | None |
| A0A099P4Y5 | 30-208 | None |
| A0A7M5TZ37 | 12-163 | None |
| A0A0D8XT98 | 6-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.