DPCstruct | MC17761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1NT48 | 2-144 | TAAAVFLPAGLPREGRVAFWDPEQGPAPQGPPGAETTELTVVRRHGAGAHSRKVAALVLPVTEALPALVRARHHPAAHPAAACWGAA… |
| A0A1C6SBN5 | 11-132 | HPVTFAPADPPRAGALLVWVDDGDRRVDLAVPPDGSVTVVTVRPVPIAEAVGPLLAVPAGAHPAAVFWAGAAREALHLAARGLVWPA… |
| A0A542U4D4 | 39-151 | None |
| A0A6I6N2V8 | 17-166 | None |
| A0A562D6F8 | 9-161 | None |
| A0A498B3L5 | 6-138 | None |
| G2G8V8 | 1-134 | None |
| A0A6N9VTE6 | 1-113 | None |
| A0A2P7PQG6 | 1-133 | None |
| A0A7W8B3I1 | 15-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.