DPCstruct | MC1776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256YLL3 | 31-110 | RYCFYQGTNERMSLSEARIIAENSECTQEGPLKNTSMCNAITGTWWIDLDVQKENCNPACVVNILTKNATINWRCRGLVK |
| A0A2H9PQR9 | 15-96 | LTIFISGCNNNNSTKDQAISLAEKSECGQAAYLTEEINHNEYTNTWWINLKMKEPKTGCNPACVINLEQKTAEINWRCTGLL |
| A0A420Z6J5 | 170-242 | None |
| A0A0P8C3N1 | 26-118 | None |
| A0A2G9LPL4 | 11-86 | None |
| A0A1F7WGY7 | 28-129 | None |
| A0A7C5FP89 | 34-122 | None |
| A0A1D2R8A8 | 488-597 | None |
| A0A661TLB1 | 44-127 | None |
| A0A497SKT0 | 54-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.