DPCstruct | MC17759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8BL00 | 15-126 | EKHQATESNSGKSLLEALPQDLLIRVLCSVDHDDLKELFHVSKTIREATLIAKQWHFAFRTPVKPMGLRSFGDLEDESKFDAQEAPN… |
| A0A1J7H2X1 | 6-117 | VEASPMKSPLEALPLDILVKVLCGVEHEDLNQLFFVSKTIREGTLIAKKTHFEYSTPKKNTFAFHDPIVIENAEVHEIEAPNAPLRK… |
| A0A5S9XUY4 | 74-190 | None |
| A0A7J0G644 | 12-149 | None |
| A0A484MJN0 | 44-161 | None |
| A0A843X9S4 | 307-425 | None |
| A0A2I0WZ23 | 31-155 | None |
| A0A699GYU6 | 94-237 | None |
| A0A2U1PJ01 | 1-97 | None |
| A0A7N0REI5 | 57-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.