DPCstruct | MC17757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 288 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PDB1 | 1-294 | MASSFVPDVWGWITSLPPFTQWNTNSMSLCICAPTSTQSSMNLSIIKNSPTKNPYITFSIFADLHVPISLWTSAPIPLKTKTQQSLD… |
| A0A1J7GT25 | 1-259 | MSLNISPSNSSQQVLNLTISKNHEFSSKLSFAIIAEFNISISLWTSKTFKPSSQNMKSIDEKTIFNLLVNFIQAILHYGSNKNSPFI… |
| A0A1R3FW24 | 1-295 | None |
| A0A3L6R118 | 1-271 | None |
| A0A5A7R0U0 | 3-298 | None |
| A0A7I8K786 | 26-302 | None |
| A0A6P6W1N1 | 79-408 | None |
| A0A314UBA3 | 25-281 | None |
| M5W168 | 3-325 | None |
| N1QU50 | 21-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.