DPCstruct | MC17756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 327 ± 54 aa |
| Standard deviation of domain lengths | 53.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 48.99 |
| Assigned Pfam label(s) | PF03223- PF01496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J7GPC0 | 214-528 | VDSYLTRFVWDEAKYPTFNIPNLRVGTLDSLLSLSDDLAKSNNFMEGVSHKIRRQIEELERVSGGDSGGLTVDGVPVDSYLTRFVWD… |
| A0A3R7C4L8 | 533-883 | MSEFWIISLPGERNPDEVFERLNASLSKYPGLSSQWKFSIPTDLKVGTLDVLVGLSDELAKLDIYAESITKKVAQYMGDVLEEQRHK… |
| U6LLC4 | 30-511 | None |
| A0A3M7M387 | 3-375 | None |
| A0A226F5A8 | 12-361 | None |
| A0A2H6K6U7 | 7-393 | None |
| A0A0C2JFI5 | 11-354 | None |
| A0A7C6XZQ2 | 14-243 | None |
| A0A7R9U1L6 | 29-487 | None |
| A0A182F8F2 | 435-788 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.