DPCstruct | MC17753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 113 ± 18 aa |
| Standard deviation of domain lengths | 17.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U0YRY6 | 3-112 | HGTPEPKPGEPPTKTAKDVRAALDPLPRGDGKSLTRDVRTTPSSNDLREQFRSLPEGAGRGPTPGYPGDQRILSDGTTIGLREKTNS… |
| A0A1F9G3Y2 | 256-348 | PSITDVLRPGGRLIGEAGTSAQIRILKGGSAEAQALFGQISQGGSVVDETSYPGTLVMLPGGGQVGYRPTSRSGPPTIDVVVEGLGI… |
| A0A1F3KVU5 | 155-252 | None |
| G1WKL7 | 8-117 | None |
| A0A4U8SC61 | 6-102 | None |
| A0A4U8S662 | 2-95 | None |
| A0A221VX11 | 71-195 | None |
| A0A0P8BQS8 | 188-282 | None |
| A0A7W3W1Z1 | 345-434 | None |
| A0A520XRF5 | 492-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.