DPCstruct | MC17751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 208 ± 39 aa |
| Standard deviation of domain lengths | 39.39 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 98.37 |
| Assigned Pfam label(s) | PF13850- PF01988- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4NEZ1 | 2-142 | ITTLGLIVGLHSGTHSKLAVIGGILTIAIADAFSDALGIHMSEESEAKHSSKEIWESTASTFLFKFTFALTFIVPVIMFDLTTAIIA… |
| A0A1I3QF69 | 1-222 | MEYKSAHEEPHFIDRAGWLRAAVLGANDGIVSVSSLIVGVAAADPGRSAILVAGAAALAAGAMSMAAGEYVSVSSQADVERADIVRE… |
| A0A3D3ZGV2 | 18-175 | None |
| A0A258L5V6 | 28-269 | None |
| A0A834SHJ9 | 27-210 | None |
| A0A0G4HZ19 | 80-320 | None |
| A0A812PKF7 | 317-513 | None |
| A0A5N6PQE8 | 13-191 | None |
| A0A0K2RE63 | 3-161 | None |
| A0A438DGV2 | 4-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.