DPCstruct | MC1775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9EXF0 | 30-100 | KPRPEKVVRLGLVRAKGFLYLLDAELTVLRAARDPETDELSAPEPVQRIEHVREAGWFYFLDADGDLARLP |
| A0A2H9PPX1 | 3-80 | MAEVVAKTGVKKESGYLYFIDKLGNVARAEMSRAGRKKGKAKKEVVAKTGVKKESGYLYFIDKKGNVCRAKMARGRKA |
| A0A842NVI4 | 45-122 | None |
| A0A3M1FB35 | 69-141 | None |
| A0A1F9QPI6 | 1-75 | None |
| A0A850BMJ8 | 4-77 | None |
| A0A1E3X923 | 4-85 | None |
| A0A842UCI7 | 3-81 | None |
| A0A523K8F5 | 1-79 | None |
| A0A523JL65 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.