DPCstruct | MC17749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 176 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8B6R2 | 1-165 | MGLTIGVSLLALTGCAERRARAFPWATAVLVHPRLPTQVVPTLDGEPPPDLRPSIPETPLRLIAHSVPPRPRETSRGSQPVLVPQLS… |
| A0A2U3LMX6 | 19-201 | CVLKGKPATATAVPVVPKPAAVAPPPTPPPPLSIPQVHPELPAPQPVSAEARATTEPPGEPPAPPPAPPRVTKKGNTPARPRPEAPP… |
| A0A2V9ZCG5 | 24-221 | None |
| A0A5M8SZ07 | 1-193 | None |
| A0A7V9NH64 | 8-195 | None |
| A0A2V9L837 | 52-226 | None |
| A0A522PYD2 | 1-160 | None |
| A0A538TUZ8 | 20-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.