DPCstruct | MC17747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 14.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417HSS0 | 5-97 | KTYSSYNHRRYSIPWIALVDPRTAKPDFSQKVGGYTGDAGEEGDLFLFEPIENAVYMYGQKDYRGNNTERVYAQYLNGEFHVIPRTD… |
| A0A1I2VDQ4 | 54-145 | PAAPKTTTLTFHTGKGRRDRAWLARVTGKDARYGFARHFLRGTEFWDNGNKVRFDIELTEDAAFEDNAYGYYVVRDGALVELADKAA… |
| A0A840TS70 | 60-187 | None |
| T3D5S0 | 1-131 | None |
| A0A7Y0XY32 | 2-124 | None |
| A0A7T9C9Z1 | 105-246 | None |
| A0A238WTD5 | 5-123 | None |
| A0A6M3JS90 | 1-130 | None |
| A0A1X1N069 | 5-138 | None |
| A0A7G6DYF8 | 9-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.